Trademarks Directory

Browse By
  • 1
  • 178
  • 179
  • 180
  • 181
  • 182
  • 644
BOND NO. 9 QUEENSESCARALEMON DROPSERVICEMARK SOLUTIONSWAHL LITHIUM IONBRANDY & MELVILLECATNIP FEVERMAX-I-PROBEBUILD TRUST TAKE THE LEAD SHARE YOUR HEARTMVGSOFT ON HANDSCAREGIVERSTRESS.COMBORROWERCONNECTOPTIC WHITEITIPSPANCAKES TO THE PEOPLEDETAIL-CLEAN ROTATION SYSTEMTHE FAMILY MAP INVENTORIESPP PARTICULAR PAWSPARTICULAR PAWSHALODROLREVIVARANT GPRECISION PROTEINUAPB GOLDEN LIONSULTIMATE ORANGE THE ORIGINAL PROTEIN ENERGY POWDER! ORIGINAL FLAVORDICOBALENE-VTRAVELERBLACK MAMBA HYPERRUSHMOUNTAINSIDELOMA LINDA BLUELOMA BLUEA RECOVERY BUILT TO LAST A LIFETIMEBESPOKE RECOVERYBUILD A BETTER MUSCLEBUILD A BETTER MUSCLE FASTERGET THERE FROM HEREDRIVE WITH FINANCIAL FLEXIBILITYBLUE SAPPHIRE LEDCARNOSYNEBIN NEW YORKM92 PVDRACOO-PAPN-PAPPROBIOTICXLSKIN RESEARCH LABORATORIES NEURADIANCECHICKEN OF THE SEA TO-GO CUPSCLEARPHAGERAPIDRENEWULTRAMAXAMERICAN HEALTHCARE RESOURCESRAS47THE AMERICAN AKCANDY COLORSOMEGAXL SPORTINTERNAL ECOSYSTEMM85 NPM90 NPEZ-CAREC39V2WEIGHTOLIVEVERSASPA BOTANLIPOTANONE HOUR PLUMBINGBLUEROCKRMOASISMYST-XCIELI DI SETA SALVATORE FERRAGAMOTUMMY TANKPERFORMANCE CLIMATE CHANGERHEARTLAND QUALITY OMAHA STEAKS SINCE 1917OMAHA STEAKS PRIVATE RESERVEREVEEMPOWERYUMMIE1800CONTACTS.COMATLASCUSTOMCOMPTIME BOMBREJUVENATE REFRESHERREJUVENATE AUTOENTREPRENEURS WITHOUT BORDERSLINEBACKER UKETTLEWORXCHROMIUMKT TAPEWORLD PORT SEAFOODFITBITNAMIWALKSNAMIFLOODLIGHTFIREFLYPOWER-GUARDLH0 FLEXPOINT0 FLEX SLIMFUSIONBAZARNYFKBTRAVERSEFLEX DEFENSEFEMI COLLECTIONLCATOMICNOTHING'S TOUGHERNUTRI-LINKWAZEPRECISETRACKON POINT PREFERREDWE WERE MADE TO MOVEJ.C. NEWMAN CIGAR CO.AED ANYTIMEAFTHEARTHUBFLEX FITLUXURY HEIGHTSAVING STROKESTHE CHEF'S TABLE CGOLIATHMINO PLUSTHE HEART OF DIABETESBAZOOKAITEKSORTIEITCH NIXSTING SOOTHEBRICK HOUSEJULIUS CAESERREACTCOCOA NUGGETSMAKE A PACT, KNOW HOW TO ACTT8CAROTÏS MINO+PLUSCYBERFIRSTTOTAL INTENSITYPROFESSIONÄLMY BIGGEST LASHESBELLWETHERSIMPLE FITSLEEPWEAVERE-CARMAALL FLAVOR. NO STING.SMART FITPERFECTWAVEFASTENCIRCADIANCEGLILINKAXONPILAYOOCTAGON GIRLBUCKLITE MAXSTAR SANPBWBUSY BAKERSANICLEANGIVE. SAVOR. CELEBRATE.PARITYOCEAN EXPRESSHIGHBRIDGEROTOGREEN PLANET-FRIENDLY PLUMBINGSERVE WITH PRIDEUFC PRIMETIMEROTOGREEN EARTH-FRIENDLY PLUMBINGFORESEEMORNINGWAREPREPARE TO SMILEROTO-ROOTER SEWER SOLUTIONSJUPITER SULPHUR LLCVENTURE 3STAFFING QUALITY PROCESSQUALITY 12345 MARKET ANALYTICS CUSTOMER KNOWLEDGE SOURCING STRATEGY SCREENING &SELECTION RELATIONSHIP MANAGEMENTMAKING A DIFFERENCESOLITAIREFLIPSIDEWAKE UP ROASTKOVERAGEGRIP RITE SHINGLELAYMENTPRO-TWIST DARTSNATURE MADE IMMUNI-CTRAVELERS INSTITUTEINDIOBEE 92BECAUSE I CANMY BLACKEST LASHESINSPIRATIONHEART360UFC GYMSPECTATORIT'S BETTER UNDER THE UMBRELLAGRIP-RITE SHINGLELAYMENTBARDSTOWN WHISKEY SOCIETY BLET ATLAS TAKE YOU HOMEJETONTURNSPRAYKENTUCKY HERITAGE COLLECTIONFRONTO KINGFLIPSTREAM
  • 1
  • 178
  • 179
  • 180
  • 181
  • 182
  • 644